KIAA0494 Polyclonal antibody

• 

  WB analysis using 19569-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19569-1-AP (KIAA0494 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SMMC-7721 using 19569-1-AP

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 19569-1-AP (KIAA0494 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  WB analysis of HeLa using 19569-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 19569-1-AP (KIAA0494 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 19569-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 19569-1-AP (KIAA0494 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

KIAA0494 Polyclonal Antibody for WB, ELISA

Cat No. 19569-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

KIAA0494, RP11 8J9.3

---

Tested Applications

• Positive WB detected in: COLO 320 cells, SMMC-7721 cells, HeLa cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19569-1-AP targets KIAA0494 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13757

  Product name: Recombinant human KIAA0494 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 145-495 aa of BC002525

  Sequence: MGLNKVWINITEMNKQISLLTSAVNHLKANVKSAADLISLPTTVEGLQKSVASIGNTLNSVHLAVEALQKTVDEHKKTMELLQSDMNQHFLKETPGSNQIIPSPSATSELDNKTHSENLKQDILYLHNSLEEVNSALVGYQRQNDLKLEGMNETVSNLTQRVNLIESDVVAMSKVEKKANLSFSMMGDRSATLKRQSLDQVTNRTDTVKIQSIKKEDSSNSQVSKLREKLQLISALTNKPESNRPPETADEEQVESFTSKPSALPKFSQFLGDPVEKAAQLRPISLPGVSSTEDLQDLFRKTGQDVDGKLTYQEIWTSLGSAMPEPESLRAFDSDGDGRYSFLELRVALGI

• Full Name: KIAA0494
• Calculated Molecular Weight: 495 aa, 55 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: BC002525
• Gene Symbol: KIAA0494
• Gene ID (NCBI): 9813
• RRID: AB_2878591
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75071
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The function of KIAA0494 remains largely unknown.