UFL1 Polyclonal antibody

• 

  WB analysis of HEK-293T using 26087-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 26087-1-AP (KIAA0776 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 26087-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 26087-1-AP (UFL1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 26087-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 26087-1-AP (UFL1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

UFL1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26087-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

KIAA0776, E3 UFM1 protein ligase 1, E3 UFM1-protein ligase 1, E3 UFM1-protein transferase 1, EC:2.3.2.-

---

Tested Applications

• Positive WB detected in: HEK-293T cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 6 publications below
• WB: See 9 publications below
• IHC: See 3 publications below
• IF: See 5 publications below
• IP: See 1 publications below

Product Information

26087-1-AP targets UFL1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23404

  Product name: Recombinant human KIAA0776 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC036379

  Sequence: MADAWEEIRRLAADFQRAQFAEATQRLSERNCIEIVNKLIAQKQLEVVHTLDGKEYITPAQISKEMRDELHVRGGRVNIVDLQQVINVDLIHIENRIGDIIKSEKHVQLVLGQLIDENYLDRLAEEVNDKLQESGQVTISELCKTYDLPGNFLTQALTQRLGRIISGHIDLDNRGVIFTEAFVARHKARIRGLFSAITRPTAVNSLISKYGFQEQLLYSVLEELVNSGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDSFFRQNGYLEFDALSRLGIPDAVSYIKKRYKTTQLLFLKAACVGQGLVDQVEASVEEAISSGTWVDIAPLLPTSLSVEDAAILLQQVMRAFS

• Full Name: KIAA0776
• Observed Molecular Weight: 80 kDa; 100 kDa
• GenBank Accession Number: BC036379
• Gene Symbol: KIAA0776
• Gene ID (NCBI): 23376
• RRID: AB_2880370
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94874
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Mol Cell; An Epstein-Barr virus protein interaction map reveals NLRP3 inflammasome evasion via MAVS UFMylation; Authors - Stephanie Pei Tung Yiu
mouse	WB,IF	Oxid Med Cell Longev; UFM1-Specific Ligase 1 Ligating Enzyme 1 Mediates Milk Protein and Fat Synthesis-Related Gene Expression via the JNK Signaling Pathway in Mouse Mammary Epithelial Cells.; Authors - Meiqian Kuang ; KO Validated
bovine	WB,IHC,IF	Cell Stress Chaperones; Protective effects of UFL1 against endoplasmic reticulum stress-induced autophagy in bovine mammary epithelial cells.; Authors - Meiqian Kuang ; KD Validated
bovine	WB	In Vitro Cell Dev Biol Anim; UFL1 regulates milk protein and fat synthesis-related gene expression of bovine mammary epithelial cells probably via the mTOR signaling pathway.; Authors - Chengmin Li ; KD Validated
bovine	IHC,IF	Biomolecules; UFL1 Alleviates LPS-Induced Apoptosis by Regulating the NF-κB Signaling Pathway in Bovine Ovarian Granulosa Cells.; Authors - Xinling Wang
bovine	WB,IHC,IF	Oxid Med Cell Longev; UFL1 Alleviates Lipopolysaccharide-Induced Cell Damage and Inflammation via Regulation of the TLR4/NF-κB Pathway in Bovine Mammary Epithelial Cells.; Authors - Chengmin Li ; KD Validated