UFL1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UFL1 Polyclonal antibody (26087-1-AP)

• Featured Product
• KD/KO Validated

UFL1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26087-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

KIAA0776, E3 UFM1 protein ligase 1, E3 UFM1-protein ligase 1, E3 UFM1-protein transferase 1, EC:2.3.2.-

• 

  WB analysis of HEK-293T using 26087-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 26087-1-AP (KIAA0776 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 26087-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 26087-1-AP (UFL1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 26087-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 26087-1-AP (UFL1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for UFL1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26087-1-AP targets UFL1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23404

  Product name: Recombinant human KIAA0776 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC036379

  Sequence: MADAWEEIRRLAADFQRAQFAEATQRLSERNCIEIVNKLIAQKQLEVVHTLDGKEYITPAQISKEMRDELHVRGGRVNIVDLQQVINVDLIHIENRIGDIIKSEKHVQLVLGQLIDENYLDRLAEEVNDKLQESGQVTISELCKTYDLPGNFLTQALTQRLGRIISGHIDLDNRGVIFTEAFVARHKARIRGLFSAITRPTAVNSLISKYGFQEQLLYSVLEELVNSGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDSFFRQNGYLEFDALSRLGIPDAVSYIKKRYKTTQLLFLKAACVGQGLVDQVEASVEEAISSGTWVDIAPLLPTSLSVEDAAILLQQVMRAFS

• Full Name: KIAA0776
• Observed Molecular Weight: 80 kDa; 100 kDa
• GenBank Accession Number: BC036379
• Gene Symbol: KIAA0776
• Gene ID (NCBI): 23376
• RRID: AB_2880370
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94874
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Anti-UFL1 antibody (Cat# 26087-1-AP) has 17 citations published in journals including Signal Transduction and Targeted Therapy, Molecular Cell, EMBO Journal, Cancer Letters, Free Radical Biology and Medicine, Oxidative Medicine and Cellular Longevity, Cell Death & Disease, and others. Research fields span UFMylation biology, cancer (glioblastoma, hepatocellular carcinoma, pancreatic cancer), inflammation, apoptosis, lipid metabolism, ER stress, autophagy, pyroptosis, and antibacterial immunity.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Signal Transduct Target Ther; Dual-targeting pharmacological UFMylation inhibition reprograms tumor and immune microenvironments to achieve long-term glioblastoma regression.; Authors - Pengcheng Tan
human	WB	J Adv Res; Panaxatriol exerts anti-senescence effects and alleviates osteoarthritis and cartilage repair fibrosis by targeting UFL1; Authors - Biao Kuang
		Mol Cell; An Epstein-Barr virus protein interaction map reveals NLRP3 inflammasome evasion via MAVS UFMylation; Authors - Stephanie Pei Tung Yiu
human	IHC	Cell Death Dis; The RASSF1C-HIF-1α axis drives macrophage lipid metabolism to promote pancreatic cancer.; Authors - Ting Zhan
human	WB,IP	Cancer Lett; CDK5RAP3 is a novel super-enhancer-driven gene activated by master TFs and regulates ER-Phagy in neuroblastoma; Authors - Ran Zhuo
human	WB	Cancer Lett; DysUFMylation reprograms immunosuppressive neutrophils to potentiate anti-PD-1 therapy in hepatocellular carcinoma.; Authors - Xukang Gao ; KD Validated