KIAA1024 Polyclonal antibody

• 

  WB analysis using 32467-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32467-1-AP (KIAA1024 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

KIAA1024 Polyclonal Antibody for WB, ELISA

Cat No. 32467-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

---

Tested Applications

• Positive WB detected in: rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32467-1-AP targets KIAA1024 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38274

  Product name: Recombinant human KIAA1024 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 742-891 aa of NM_015206.2

  Sequence: VGLNEEEIKDTGPGDNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPASLKAHMKSNPLYTDMRLTELAEVKRGQPSWTIEEYARNAGDKGKLTALDLQTQESLNPNNLEYWMEDIYTPGYDSLLKRKEAEFRRAKVCK

• Full Name: KIAA1024
• Calculated Molecular Weight: 103kDa，916aa
• Observed Molecular Weight: 102 kDa
• GenBank Accession Number: NM_015206.2
• Gene Symbol: KIAA1024
• Gene ID (NCBI): 23251
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UPX6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KIAA1024 negatively regulates the activities of mTORC1 and mTORC2 by stabilizing the MTOR complex inhibitor DEPTOR, thus inhibiting cell overgrowth. In cultured hippocampal neurons and PC12 cells, knocking down KIAA1024 can activate mTOR signal and promote neurite outgrowth. However, in zebrafish and mouse transplanted tumor models, deletion of this gene will significantly enhance the tumor formation induced by HRAS(G12V), suggesting that it has antitumor effect.