KIAA1191 Polyclonal antibody

• 

  WB analysis of mouse ovary using 20637-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 20637-1-AP (KIAA1191 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse uterus using 20637-1-AP

  mouse uterus tissue were subjected to SDS PAGE followed by western blot with 20637-1-AP (KIAA1191 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 20637-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 20637-1-AP (KIAA1191 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 20637-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using KIAA1191 antibody (20637-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

• Featured Product
• KD/KO Validated

KIAA1191 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20637-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Putative monooxygenase p33MONOX, P33MONOX, Flavin monooxygenase motif-containing protein of 33 kDa, EC:1.-.-.-

---

Tested Applications

• Positive WB detected in: mouse ovary tissue, mouse uterus tissue
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

20637-1-AP targets KIAA1191 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14694

  Product name: Recombinant human KIAA1191 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 154-305 aa of BC006316

  Sequence: KLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVMEGKKQPPRAHNLKPRDLNVLTPTGF

• Full Name: KIAA1191
• Calculated Molecular Weight: 305 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC006316
• Gene Symbol: KIAA1191
• Gene ID (NCBI): 57179
• RRID: AB_10693625
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96A73
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Ann Hematol; The role of KIAA1191 in the necroptotic pathway of multiple myeloma.; Authors - Zhao Xu ; KD Validated