KIAA1199 / CEMIP Polyclonal antibody

• 

  WB analysis using 31106-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31106-1-AP (KIAA1199 / CEMIP antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 31106-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 31106-1-AP (KIAA1199 / CEMIP antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 31106-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using KIAA1199 / CEMIP antibody (31106-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

KIAA1199 / CEMIP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 31106-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

KIAA1199, CEMIP, Protein KIAA1199, HYBID, Hyaluronan binding protein involved in hyaluronan depolymerization

---

Tested Applications

• Positive WB detected in: HCT 116 cells, HT-1080 cells
• Positive IHC detected in: human colon cancer; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31106-1-AP targets KIAA1199 / CEMIP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34315

  Product name: Recombinant human KIAA1199 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 180-420 aa of BC020256

  Sequence: FERSWGHRGVIVHVIDPKSGTVIHSDRFDTYRSKKESERLVQYLNAVPDGRILSVAVNDEGSRNLDDMARKAMTKLGSKHFLHLGFRHPWSFLTVKGNPSSSVEDHIEYHGHRGSAAARVFKLFQTEHGEYFNVSLSSEWVQDVEWTEWFDHDKVSQTKGGEKISDLWKAHPGKICNRPIDIQATTMDGVNLSTEVVYKKGQDYRFACYDRGRACRSYRVRFLCGKPVRPKLTVTIDTNVN

• Full Name: KIAA1199 / CEMIP
• Calculated Molecular Weight: 1361 aa, 153 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC020256
• Gene Symbol: KIAA1199
• Gene ID (NCBI): 57214
• RRID: AB_3669858
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8WUJ3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KIAA1199, also known as CEMIP, was first discovered as an inner-ear protein whose genetic mutations were linked to nonsyndromic hearing loss. KIAA1199 is involved in hyaluronan degradation. Studies have shown that KIAA1199 is overexpressed in many types of cancers, suggesting a critical role of KIAA1199 in cancer progression.