KIAA1211 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KIAA1211 Polyclonal antibody (32570-1-AP)

• 

  WB analysis using 32570-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32570-1-AP (KIAA1211 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

KIAA1211 Polyclonal Antibody for WB, ELISA

Cat No. 32570-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Cancer-related regulator of actin dynamics, Capping protein-inhibiting regulator of actin dynamics, CRACD, CRAD

---

Tested Applications

• Positive WB detected in: HeLa cells, SH-SY5Y cells, SK-N-SH cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32570-1-AP targets KIAA1211 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38501

  Product name: Recombinant human KIAA1211 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 430-580 aa of NM_020722.1

  Sequence: LEDQERLKPEGQREHSEEPGICEEQNPEAERRREQQGRSGDFQGADRPGPEEKREEGDTEPLLKQEGPVEAAQPPVERKEAAALEQGRKVEELRWQEVDERQTMPRPYTFQVSSGGKQILFPKVNLSPVTPAKDTGLTAAPQEPKAPKASP

• Full Name: KIAA1211
• Calculated Molecular Weight: 137kDa，1233aa
• Observed Molecular Weight: 137 kDa
• GenBank Accession Number: NM_020722.1
• Gene Symbol: KIAA1211
• Gene ID (NCBI): 57482
• RRID: AB_3742658
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6ZU35
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KIAA1211 locates at human chromosome 4q12, and has only one transcript (NM_020722.1, 4914 bp). KIAA1211 encoded a 137 kDa nuclear protein and highly expressed in the brain cerebral cortex. Furthermore, it is localized to the microtubules and the centrosomes and is subcellularly located in the nucleus. In recent years, it has been found that the KIAA1211 gene is closely associated with the development and prognosis of various cancers (PMID: 31777604).