RIC1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RIC1 Polyclonal antibody (32377-1-AP)

• 

  WB analysis using 32377-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32377-1-AP (KIAA1432 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 32377-1-AP

  IP result of anti-RIC1 (IP:32377-1-AP, 4ug; Detection:32377-1-AP 1:1000) with HeLa cells lysate 1880 ug.

RIC1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 32377-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

CIP150, KIAA1432, Protein RIC1 homolog, Q4ADV7

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue, rat pancreas
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32377-1-AP targets RIC1 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36426

  Product name: Recombinant human KIAA1432 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 820-1054 aa of BC136616

  Sequence: QTVVHCARKTEYALWNYLFAAVGNPKDLFEECLMAQDLDTAASYLIILQNMEVPAVSRQHATLLFNTALEQGKWDLCRHMIRFLKAIGSGESETPPSTPTAQEPSSSGGFEFFRNRSISLSQSAENVPASKFSLQKTLSMPSGPSGKRWSKDSDCAENMYIDMMLWRHARRLLEDVRLKDLGCFAAQLGFELISWLCKERTRAARVDNFVIALKRLHKDFLWPLPIIPASSISSP

• Full Name: KIAA1432
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC136616
• Gene Symbol: KIAA1432
• Gene ID (NCBI): 57589
• RRID: AB_3742587
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q4ADV7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RIC1 (RAB6A GEF complex partner 1) is a protein that plays a critical role in intracellular membrane trafficking. It encodes a protein of 1056 amino acid (aa) residues, including a putative nuclear localisation sequence (PMID: 9099877). Ric1 is composed of two β-propellers and a C-terminal α-solenoid domain that remodels the Rab6 nucleotide-binding pocket to facilitate nucleotide exchange (PMID: 39632878). RIC1 proteins play important roles in vesicular trafficking, regulation of membrane dynamics, cell division and signalling, and are essential for maintaining normal cellular function.