KIAA1522 Polyclonal antibody

• 

  IHC staining of human lung squamous cell carcinoma using 31198-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung squamous cell carcinoma tissue slide using 31198-1-AP (KIAA1522 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung squamous cell carcinoma using 31198-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung squamous cell carcinoma tissue slide using 31198-1-AP (KIAA1522 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

KIAA1522 Polyclonal Antibody for IHC, ELISA

Cat No. 31198-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

NHSL3

---

Tested Applications

• Positive IHC detected in: human lung squamous cell carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31198-1-AP targets KIAA1522 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35083

  Product name: Recombinant human KIAA1522 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 900-1035 aa of NM_001198972

  Sequence: EPRPPQSPASTASFIFSKGSRKLQLERPVSPETQADLQRNLVAELRSISEQRPPQAPKKSPKAPPPVARKPSVGVPPPASPSYPRAEPLTAPPTNGLPHTQDRTKRELAENGGVLQLVGPEEKMGLPGSDSQKELA

• Full Name: KIAA1522
• Calculated Molecular Weight: 107 kDa
• GenBank Accession Number: NM_001198972
• Gene Symbol: KIAA1522
• Gene ID (NCBI): 57648
• RRID: AB_3669896
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9P206
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

It is important to investigate the role of the big protein-coding gene KIAA1522. The mRNA expression of KIAA1522 was elevated in a number of malignancies, according to data from the Gene Expression Atlas and The European Bioinformatics Institute databases, which showed that abnormal KIAA1522 expression may have a role in the pathogenesis and growth of cancer. (PMID: 36761433)