Shootin 1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 86541-2-RR (same clone as 86541-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86541-2-RR (KIAA1598 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86541-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 86541-2-RR (same clone as 86541-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86541-2-RR (KIAA1598 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86541-2-PBS in a different storage buffer formulation.

• 

  Sample test of MP02499-1

  The mean Shootin 1 concentration was determined to be 50.1 ng/mL in SH-SY5Y cell extract based on a 1.4 mg/mL extract load, 47.7 ng/mL in Neuro-2a cell extract based on a 1.6 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02499-1

  Cytometric bead array standard curve of MP02499-1, Shootin 1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86541-2-PBS. Detection antibody: 86541-1-PBS. Standard: Ag18294. Range: 0.781-100 ng/mL.

• 

  Affinity and Kinetic Characterization of 86541-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86541-2-RR against Human Shootin 1 were performed. The affinity constant is 0.965 nM.

Shootin 1 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA, Sample test

Cat No. 86541-2-PBS

Clone No.251435E5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA, Sample test

Synonyms

SHTN1, KIAA1598, Shootin-1

---

Product Information

86541-2-PBS targets Shootin 1 as part of a matched antibody pair:

MP02499-1: 86541-2-PBS capture and 86541-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18294

  Product name: Recombinant human KIAA1598 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 834-1066 aa of BC022348

  Sequence: TEEVTDLKRQAVEEMMDRIKKGVHLRPVNQTARPKTKPESSKGCESAVDELKGILGTLNKSTSSRSLKSLDPENSETELERILRRRKVTAEADSSSPTGILATSESKSMPVLGSVSSVTKTALNKKTLEAEFNSPSPPTPEPGEGPRKLEGCTSSKVTFQPPSSIGCRKKYIDGEKQAEPVVVLDPVSTHEPQTKDQVAEKDPTQHKEDEGEIQPENKEDSIENVRETDSSNC

• Full Name: KIAA1598
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 60-80 kDa
• GenBank Accession Number: BC022348
• Gene Symbol: Shootin 1
• Gene ID (NCBI): 57698
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: A0MZ66
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Shootin 1, also known as SHTN1, KIAA1598, contains 3 coiled-coil domains and a proline-rich region. Shootin 1 is involved in generating internal asymmetric signals required for neuronal during stages 2 and 3. Shootin 1 plays a role in cytoskeletal organization by regulating the subcellular localization of phosphoinositide 3-kinase (PI3K) activity at the axonal growth cone. SHTN1 produces 2 splice variants, a short variant, SHTN1S, that lacks exons 15 and 16, and a long variant, SHTN1L, that includes exons 1 through 17(PMID: 17030985, 30733148).