KIAA1797 Polyclonal antibody

• 

  WB analysis using 30140-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30140-1-AP (KIAA1797 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 30140-1-AP

  WB result of KIAA1797 antibody (30140-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-KIAA1797 transfected HeLa cells.

• 

  IF Staining of HeLa using 30140-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using KIAA1797 antibody (30140-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

KIAA1797 Polyclonal Antibody for WB, ELISA

Cat No. 30140-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, ELISA

Synonyms

FLJ20375, KIAA1797

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, Neuro-2a cells, SH-SY5Y cells, U-251 cells, C6 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30140-1-AP targets KIAA1797 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31233

  Product name: Recombinant human KIAA1797 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 230-502 aa of BC001246

  Sequence: LLSEATGKIFDLLPNKIRRKDLELYISIAKCLLEMTDDDANRIAQVTKSNIEKAAFVKLYLVSQGRFPLVNLTDMLSVAVQHREKEVLAWMILHSLYQARIVSHANTGVLKRMEWLLELMGYIRNVAYQSTSFHNTALDEALDFFLLIFATAVVAWADHTAPLLLGLSASWLPWHQENGPAGPVPSFLGRSPMHRVTLQEVLTLLPNSMALLLQKEPWKEQTQKFIDWLFSIMESPKEALSAQSRDLLKATLLSLRVLPEFKKKAVWTRAYGW

• Full Name: KIAA1797
• Observed Molecular Weight: 160-170 kDa
• GenBank Accession Number: BC001246
• Gene Symbol: KIAA1797
• Gene ID (NCBI): 54914
• RRID: AB_3086244
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VW36
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KIAA1797 is a novel component of the focal adhesion complex expressed in glial and neuronal cells with a tumour suppressor function in gliomas, which is also named 'focadhesin' (PMID: 22427331).