KIF13A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KIF13A Polyclonal antibody, PBS Only (27210-1-PBS)

• 

  WB analysis of HepG2 using 27210-1-AP (same clone as 27210-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 27210-1-AP (KIF13A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27210-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 27210-1-AP (same clone as 27210-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27210-1-AP (KIF13A antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27210-1-PBS in a different storage buffer formulation.

KIF13A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27210-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

27210-1-PBS targets KIF13A in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24356

  Product name: Recombinant human KIF13A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1377-1560 aa of BC127115

  Sequence: RHIRRSLSTPNVHNVSSSRPDLSGFDEDDKGWPENQLDMSDYSSSYQDVACYGTLPRDSPRRNKEGCTSETPHALTVSPFKAFSPQPPKFFKPLMPVKEEHKKRIALEARPLLSQEDSEEEENELEAINRKLISSQPYVPVEFADFSVYNASLENREWFSSKVDLSNSRVLEKEVSRSPTTSSI

• Full Name: kinesin family member 13A
• Calculated Molecular Weight: 1805 aa, 202 kDa
• Observed Molecular Weight: 202 kDa
• GenBank Accession Number: BC127115
• Gene Symbol: KIF13A
• Gene ID (NCBI): 63971
• RRID: AB_2880802
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H1H9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.