KIF2B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KIF2B Polyclonal antibody, PBS Only (13711-1-PBS)

• 

  WB analysis of mouse brain using 13711-1-AP (same clone as 13711-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13711-1-AP (KIF2B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13711-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 13711-1-AP (same clone as 13711-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 13711-1-AP (KIF2B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13711-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 13711-1-AP (same clone as 13711-1-PBS)

  IP result of anti-KIF2B (IP:13711-1-AP, 4ug; Detection:13711-1-AP 1:1000) with mouse testis tissue lysate 4000ug. This data was developed using the same antibody clone with 13711-1-PBS in a different storage buffer formulation.

KIF2B Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 13711-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

13711-1-PBS targets KIF2B in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4648

  Product name: Recombinant human KIF2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC033802

  Sequence: MASQFCLPESPCLSPLKPLKPHFGDIQEGIYVAIQRSDKRIHLAVVTEINRENYWVTVEWVEKAVKKGKKIDLETILLLNPALDSAEHPMPPPPLSPLALAPSSAIRDQRTATKWVAMIPQKNQTASGDSLDVRVPSKPCLMKQKKSPCLWEIQKLQEQREKRRRLQQEIRARRALDVNTRNPNYEIMHMIEEYRRHLDSSKISVLEPPQEHRICVCVRKRPLNQRETTLKDLDIITVPSDNVVMVHESKQKVDLTRYLQNQTFCFDHAFDDKASNELVYQFTAQPLVESIFRKGMATCFAYGQTGSGKTYTMGGDFSGTAQDCSKGIYALVAQDVFLLLRNSTYEKLDL

• Full Name: kinesin family member 2B
• Calculated Molecular Weight: 673 aa, 76 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC033802
• Gene Symbol: KIF2B
• Gene ID (NCBI): 84643
• RRID: AB_2131885
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N4N8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KIF2B belongs to the TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family and MCAK/KIF2 subfamily. KIF2B is evidently required for spindle assembly, chromosome movement and cytokinesis (PMID: 17538014). The molecular weight of KIF2B is 76 kDa. It plays an important role in chromosome congression (PMID: 23891108).