KIF5A Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 84013-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 84013-2-PBS against Human KIF5A was performed. The affinity constant is 30.5 nM.

KIF5A Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 84013-2-PBS

Clone No.241124D10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

D12S1889, Kinesin heavy chain isoform 5A, Kinesin heavy chain neuron-specific 1, MY050, Neuronal kinesin heavy chain

---

Product Information

84013-2-PBS targets KIF5A in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15518

  Product name: Recombinant human KIF5A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 931-1032 aa of BC146670

  Sequence: SPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS

• Full Name: kinesin family member 5A
• Calculated Molecular Weight: 1032 aa, 117 kDa
• GenBank Accession Number: BC146670
• Gene Symbol: KIF5A
• Gene ID (NCBI): 3798
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q12840
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.