Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25897-1-AP targets KIF5C in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23163 Product name: Recombinant human KIF5C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 143-194 aa of BC110287 Sequence: AVPEDEQISAKDQKNLEPCDNTPIIDNIAPVVAGISTEEKEKYDEEISSLYR Predict reactive species |
| Full Name | kinesin family member 5C |
| Calculated Molecular Weight | 725 aa, 83 kDa |
| Observed Molecular Weight | 70 kDa, 110 kDa |
| GenBank Accession Number | BC110287 |
| Gene Symbol | KIF5C |
| Gene ID (NCBI) | 3800 |
| RRID | AB_2880288 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60282 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KIF5C (Kinesin heavy chain isoform 5C variant) which belongs to the kinesin-like protein family is neuron specific. The kinesin-1 subfamilies (kif5a, kif5b, kif5c) are responsible for the movement of mitochondria in neurons. Kinesins have N-terminal motor domains and C-terminal cargo-binding tail domains separated by hinge regions. The hinge and C-terminal tail regions of Kif5a, Kif5b, and Kif5c bound a large detergent-resistant RNase-sensitive granule. The granule localized to dendrites and underwent bidirectional movement. Distally directed movement of the granule was enhanced by Kif5 overexpression and reduced by Kif5 functional blockage. kinesins may transport RNA in dendrites via this large granule. Two major isoforms of kif5c, with molecular predicted masses of 80 and 110 kDa, are generated by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for KIF5C antibody 25897-1-AP | Download protocol |
| IHC protocol for KIF5C antibody 25897-1-AP | Download protocol |
| IP protocol for KIF5C antibody 25897-1-AP | Download protocol |
| WB protocol for KIF5C antibody 25897-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The KIF5C Polyclonal antibody (Cat# 25897-1-AP) has 11 citations published in journals including Neuron, J Biol Chem, FASEB J, Exp Mol Med, Alzheimers Res Ther, Hum Mol Genet, Neurobiol Dis, Exp Neurol, Int Endod J, iScience, and bioRxiv. Research fields span axonal transport, mitochondrial trafficking, neurodegeneration (Alzheimer's disease, CMT2A, LHON), epilepsy, cortical development, traumatic brain injury, neurogenesis, and microtubule biology.
| Species | Application | Title |
|---|---|---|
Exp Mol Med Activation of TLR7-mediated autophagy increases epileptic susceptibility via reduced KIF5A-dependent GABAA receptor transport in a murine model | ||
Neuron Species-specific FMRP regulation of RACK1 is critical for prenatal cortical development | ||
Alzheimers Res Ther Normal levels of KIF5 but reduced KLC1 levels in both Alzheimer disease and Alzheimer disease in Down syndrome: evidence suggesting defects in anterograde transport. | ||
Int Endod J Overexpression of MicroRNA-155 Aggravates Pulpitis by Targeting Kinesin Superfamily Proteins-5C Based on Illumina High-Throughput Sequencing
| ||
Neurobiol Dis Amyloid beta-mediated KIF5A deficiency disrupts anterograde axonal mitochondrial movement. | ||
Exp Neurol Axonal injury mediated by neuronal p75NTR/TRAF6/JNK pathway contributes to cognitive impairment after repetitive mTBI |
Reviews
What customers say
The single review for this product rates it 5 stars. The user performed Western Blot on mouse brain tissue at a 1:3000 dilution and reported a clear band at 120–130 kD, consistent with the expected molecular weight. However, they noted the presence of some uncharacteristic bands below 100 kD. Overall, the antibody was considered effective for its intended application despite the minor non-specific signals.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Xuqiao (Verified Customer) (08-31-2020) | It can produce a clear band at 120-130kD which matches it mw, although it also has some uncharacteristic bands below 100 kD.
 |
