KIFAP3 Monoclonal antibody

• 

  WB analysis of human testis using 60266-1-Ig

  human testis tissue were subjected to SDS PAGE followed by western blot with 60266-1-Ig (KIFAP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 60266-1-Ig

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 60266-1-Ig (KIFAP3 Antibody) at dilution of 1:50.

• 

  IHC staining of human testis using 60266-1-Ig

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 60266-1-Ig (KIFAP3 Antibody) at dilution of 1:50.

KIFAP3 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60266-1-Ig

Clone No.7C9F2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

KAP 3, KAP3, KIF3AP, KIFAP3, kinesin associated protein 3, SMAP, Smg GDS, Smg GDS associated protein

---

Tested Applications

• Positive WB detected in: human testis tissue
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60266-1-Ig targets KIFAP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20809

  Product name: Recombinant human KIFAP3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 491-792 aa of BC028679

  Sequence: SQHDGPTKNLFIDYVGDLAAQISNDEEEEFVIECLGTLANLTIPDLDWELVLKEYKLVPYLKDKLKPGAAEDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDEEWAKKIQSEKFRWHNSQWLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEGAISPDFFNDYHLQNGDVVGQHSFPGSLGMDGFGQPVGILGRPATAYGFRPDEPYYYGYGS

• Full Name: kinesin-associated protein 3
• Calculated Molecular Weight: 792 aa, 91 kDa
• Observed Molecular Weight: 91-100 kDa
• GenBank Accession Number: BC028679
• Gene Symbol: KIFAP3
• Gene ID (NCBI): 22920
• RRID: AB_2881387
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92845
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KIFAP3, also known as KIF3AP or KAP3, is a novel KIF3A/3B-associated protein. It binds to the tail domain of KIF3A/3B and may play a role in regulating the binding of KIF3A/3B to cargoes. Recently it has been reported that mutation within the KIFAP3 gene is associated with decreased KIFAP3 expression and increased survival in sporadic ALS, which makes it a potential target for ALS therapy. KIFAP3 has also been identified as the target of mir-130a.