Use Able AI chat for product recommendations

Anti-Human KIR2DL3/CD158b2 Rabbit Recombinant Antibody

KIR2DL3/CD158b2 Uni-rAb® Recombinant Antibody for IHC, FC

Cat No. 98373-3-RR
Clone No.242282E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, FC

KIR2DL3, 242282E11, CD158 antigen-like family member B2, CD158b, CD158B2

Formulation:  PBS, Azide
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98373-3-RR targets KIR2DL3/CD158b2 in IHC, FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2699

Product name: Recombinant Human KIR2DL3 protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 22-245 aa of NM_015868.2

Sequence: HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Predict reactive species
Full Name killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3
Calculated Molecular Weight38 kDa
GenBank Accession NumberNM_015868.2
Gene Symbol KIR2DL3
Gene ID (NCBI) 3804
RRIDAB_3746021
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP43628-1
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2 - 8°C. Stable for one year after shipment.

Background Information

Killer cell immunoglobulin-like receptors (KIRs) are a diverse family of inhibitory and activating receptors expressed on NK cells and a subset of T cells (PMID: 11861603). These polymorphic receptors interact with specific motifs on HLA class I molecules, modulate NK cytolytic activity and are encoded by genes located on chromosome 19q13.4 (PMID: 17069649). KIR2DL3, also known as CD158B2 or NKAT2, is an inhibitory receptor that is specific for HLA-C alleles (HLA-Cw1, HLA-Cw3 and HLA-Cw7) (PMID: 10196125). It is a 341-amino acid transmembrane glycoprotein consisting of an extracellular region containing two C2-type Ig-like domains, a 19-amino acid hydrophobic transmembrane region, and a long cytoplasmic tail with two immunoreceptor tyrosine-based inhibitory motifs (ITIMs). KIR2DL3 inhibits the cytolytic activity of NK cells thus preventing cell lysis (PMID: 7724594).

Protocols

Product Specific Protocols
FC protocol for KIR2DL3/CD158b2 antibody 98373-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...