Anti-Human KIR2DS4/CD158i Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human KIR2DS4/CD158i Rabbit Recombinant Antibody, PBS Only (98339-3-PBS)

KIR2DS4/CD158i Uni-rAb^® Recombinant Antibody for FC

Cat No. 98339-3-PBS Copied!

Clone No. 242656E10

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

KIR2DS4, CD158 antigen-like family member I, CD158I, Killer cell immunoglobulin-like receptor 2DS4, KIR1D

• 

  FC experiment of human PBMCs using 98339-3-RR (same clone as 98339-3-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human KIR2DS4/CD158i Rabbit RecAb (98339-3-RR, Clone: 242656E10) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Human NCAM1/CD56 Rabbit Recombinant Antibody (CL647-98033, Clone: 240078A7). Cells were not fixed. This data was developed using the same antibody clone with 98339-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KIR2DS4/CD158i in ?

Chat with Able

---

Product Information

98339-3-PBS targets KIR2DS4/CD158i in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4353

  Product name: Recombinant Human KIR2DS4 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-245 aa of NM_012314.6

  Sequence: QEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKFNNTLHLIGEHHDGVSKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAVRSINGTFQADFPLGPATHGGTYRCFGSFRDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

• Full Name: killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4
• Calculated Molecular Weight: 34 kDa
• GenBank Accession Number: NM_012314.6
• Gene Symbol: KIR2DS4
• Gene ID (NCBI): 3809
• RRID: AB_3745989
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P43632
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KIR2DS4 (also known as CD158i) is a member of the killer cell immunoglobulin-like receptor (KIR) family. KIRs are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. KIRs are mainly involved in inhibiting NK killing (inhibitory KIRs) via interaction with MHC class I molecules. KIR2DS4 has been reported to be an activating KIR and recognize the HLA-Cw4 protein.