KLF1 Polyclonal antibody

• 

  WB analysis of HeLa using 18887-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18887-1-AP (KLF1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 18887-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using KLF1 antibody (18887-1-AP) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

KLF1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 18887-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Krueppel-like factor 1, Krueppel like factor 1, Erythroid krueppel-like transcription factor, EKLF

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18887-1-AP targets KLF1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13467

  Product name: Recombinant human KLF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 259-362 aa of BC033580

  Sequence: AETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKRHL

• Full Name: Kruppel-like factor 1 (erythroid)
• Calculated Molecular Weight: 362 aa, 38 kDa
• GenBank Accession Number: BC033580
• Gene Symbol: KLF1
• Gene ID (NCBI): 10661
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13351
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.