Filter: AllWBIF/ICC

WB analysis of HeLa using 18887-1-AP (same clone as 18887-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 18887-1-AP (KLF1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18887-1-PBS in a different storage buffer formulation.
IF Staining of A431 using 18887-1-AP (same clone as 18887-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed A431 cells using KLF1 antibody (18887-1-AP) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 18887-1-PBS in a different storage buffer formulation.

EKLF/KLF1 Polyclonal antibody, PBS Only

Name: EKLF/KLF1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 18887-1-PBS

EKLF/KLF1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 18887-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

KLF1, EKLF, Erythroid krueppel-like transcription factor, Krueppel like factor 1, Krueppel-like factor 1

Formulation: PBS Only

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

18887-1-PBS targets EKLF/KLF1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag13467 Product name: Recombinant human KLF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 259-362 aa of BC033580 Sequence: AETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKRHL Predict reactive species
Full Name	Kruppel-like factor 1 (erythroid)
Calculated Molecular Weight	362 aa, 38 kDa
GenBank Accession Number	BC033580
Gene Symbol	KLF1
Gene ID (NCBI)	10661
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q13351
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™