KLF10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KLF10 Polyclonal antibody, PBS Only (29709-1-PBS)

• 

  WB analysis using 29709-1-AP (same clone as 29709-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29709-1-AP (KLF10 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29709-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29709-1-AP (same clone as 29709-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29709-1-AP (KLF10 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29709-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 29709-1-AP (same clone as 29709-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 29709-1-AP (KLF10 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29709-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 29709-1-AP (same clone as 29709-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 29709-1-AP (KLF10 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29709-1-PBS in a different storage buffer formulation.

KLF10 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29709-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

29709-1-PBS targets KLF10 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31772

  Product name: Recombinant human KLF10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-213 aa of BC011538

  Sequence: MEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKA

• Full Name: Kruppel-like factor 10
• Calculated Molecular Weight: 469 aa, 51 kDa
• Observed Molecular Weight: 52-75 kDa
• GenBank Accession Number: BC011538
• Gene Symbol: KLF10
• Gene ID (NCBI): 7071
• RRID: AB_2918341
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13118
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KLF10 (Krueppel-like factor 10), also known as TIEG1, is a transcription factor that plays a role in the regulation of cell growth. KLF10 plays a role in the response to TGF beta (through the TGF beta/Smad signaling pathway) and estrogen. KLF10 has been shown to have a role in skeletal disease (osteopenia/osteoporosis), hypertrophic cardiomyopathy, and breast and prostate cancer. KLF10 can be detected 51-52 kDa, 60-75 kDa (PMID: 21262377, PMID: 30026232).