KLF17 Polyclonal antibody

• 

  WB analysis of MCF-7 using 17612-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 17612-1-AP (KLF17 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 17612-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 17612-1-AP (KLF17 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

KLF17 Polyclonal Antibody for WB, ELISA

Cat No. 17612-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

KLF17, Krueppel like factor 17, Kruppel like factor 17, Zfp393, Zinc finger protein 393, ZNF393

---

Tested Applications

• Positive WB detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17612-1-AP targets KLF17 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11776

  Product name: Recombinant human KLF17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-389 aa of BC049844

  Sequence: MYGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGVHTSWNQGLPTIQHFPHSAEMLGSPLVSVEAPGQNVNEGGPQFSMPLPERGMSYCPQATLTPSRMIYCQRMSPPQQEMTIFSGPQLMPVGEPNIPRVARPFGGNLRMPPSGLPVSASTGIPIMSHTGNPPVPYPGLSTVPSDETLLGPTVPSTEAQAVLPSMAQMLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTGRRGSSEARPYCCNYENCGKAYTKRSHLVSHQRKHTGERPYSCNWESCSWSFFRSDELRRHMRVHTRYRPYKCDQCSREFMRSDHLKQHQKTHRPGPSDPQANNNNGEQDSPPAAGP

• Full Name: Kruppel-like factor 17
• Calculated Molecular Weight: 389 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC049844
• Gene Symbol: KLF17
• Gene ID (NCBI): 128209
• RRID: AB_2878419
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JT82
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.