KLHDC8B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KLHDC8B Polyclonal antibody, PBS Only (20935-1-PBS)

• 

  WB analysis using 20935-1-AP (same clone as 20935-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20935-1-AP (KLHDC8B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20935-1-PBS in a different storage buffer formulation.

KLHDC8B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20935-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

kelch domain containing 8B

---

Product Information

20935-1-PBS targets KLHDC8B in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15028

  Product name: Recombinant human KLHDC8B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 70-178 aa of BC039083

  Sequence: AGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGVATVERDGMVYALGGMGPDTAPQAQVRVYEPRRDCWLSLPSMPTPCYGASTFLHGNKIY

• Full Name: kelch domain containing 8B
• Calculated Molecular Weight: 354 aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC039083
• Gene Symbol: KLHDC8B
• Gene ID (NCBI): 200942
• RRID: AB_3742008
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IXV7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.