KLHL13 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KLHL13 Polyclonal antibody (15612-1-AP)

KLHL13 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15612-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

BKLHD2, kelch like 13 (Drosophila), Kelch like protein 13, KIAA1309, KLHL13

• 

  WB analysis of Jurkat using 15612-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15612-1-AP (KLHL13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15612-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15612-1-AP (KLHL13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 15612-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 15612-1-AP (KLHL13 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 15612-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 15612-1-AP (KLHL13 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 15612-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 15612-1-AP (KLHL13 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KLHL13 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells
• Positive IHC detected in: mouse skeletal muscle tissue, human lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15612-1-AP targets KLHL13 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8003

  Product name: Recombinant human KLHL13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 487-655 aa of BC008729

  Sequence: GGVMYISGGITHDTFQKELMCFDPDTDKWIQKAPMTTVRGLHCMCTVGERLYVIGGNHFRGTSDYDDVLSCEYYSPILDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPDKDEWHKVFDLPESLGGIRACTLTVFPPEETTPSPSRESPLSAP

• Full Name: kelch-like 13 (Drosophila)
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC008729
• Gene Symbol: KLHL13
• Gene ID (NCBI): 90293
• RRID: AB_2130739
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2N7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The KLHL13 Polyclonal antibody (Cat# 15612-1-AP) has 1 citation. It was published in Scientific Reports (2025), in a study investigating how RHOBTB2 enhances cell proliferation in acute myeloid leukemia by modulating Hippo-YAP1 signaling through KLHL13. The research field encompasses leukemia/cancer biology and Hippo-YAP1 signaling pathway. The antibody was used for Western blot and immunofluorescence in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Sci Rep; RHOBTB2 enhances cell proliferation of acute myeloid leukemia by modulating Hippo-YAP1 signaling and dependent of KLHL13.; Authors - Yao Liu