KLHL15 Polyclonal antibody

• 

  WB analysis of HeLa using 25066-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25066-1-AP (KLHL15 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 25066-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25066-1-AP (KLHL15 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 25066-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25066-1-AP (KLHL15 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 25066-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25066-1-AP (KLHL15 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human prostate cancer using 25066-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25066-1-AP (KLHL15 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 25066-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25066-1-AP (KLHL15 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 25066-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25066-1-AP (KLHL15 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 25066-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25066-1-AP (KLHL15 Antibody) at dilution of 1:50 (under 40x lens).

KLHL15 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25066-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

kelch like 15 (Drosophila), Kelch like protein 15, KIAA1677, KLHL15

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells
• Positive IHC detected in: human prostate cancer tissue, human testis tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below

Product Information

25066-1-AP targets KLHL15 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16878

  Product name: Recombinant human KLHL15 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC109058

  Sequence: MAGDVEGFCSSIHDTSVSAGFRALYEEGLLLDVTLVIEDHQFQAHKALLATQSDYFRIMFTADMRERDQDKIHLKGLTATGFSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKFCCSFLLAKICLENCAEIMRLLDDFGVNIEGVREKLDTFLLDNFVPLMSRPDFLSYLSFEKLMSYLDNDHLSRFPEIELYEAVQSWLRHDRRRWRHTDTIIQNIRFCLMTPTSVFEKVKTSEFYRYSRQLRYEVDQALNYFQNVHQQPLLDMKSSRIRSAKPQTTVFRGMIGHSMVNSKILLLKKPRVWWELEGPQVPLRPDCLAIVNNFVFLLGGEELGPDGEFHASSKVF

• Full Name: kelch-like 15 (Drosophila)
• Calculated Molecular Weight: 604 aa, 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC109058
• Gene Symbol: KLHL15
• Gene ID (NCBI): 80311
• RRID: AB_2879880
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96M94
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Micropeptide PACMP inhibition elicits synthetic lethal effects by decreasing CtIP and poly(ADP-ribosyl)ation.; Authors - Chuanchao Zhang
human	WB	Sci Adv; VGLL3 modulates chemosensitivity through promoting DNA double-strand break repair; Authors - Wei Wu ; KD Validated