KLHL2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85893-1-RR (same clone as 85893-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85893-1-RR (KLHL2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85893-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 85893-1-RR (same clone as 85893-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using KLHL2 antibody (85893-1-RR, Clone: 250148G5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85893-1-PBS in a different storage buffer formulation.

KLHL2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 85893-1-PBS

Clone No.250148G5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ABP KELCH, Actin-binding protein Mayven, Kelch-like protein 2

---

Product Information

85893-1-PBS targets KLHL2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5950

  Product name: Recombinant human KLHL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 273-593 aa of BC022503

  Sequence: DYLIEAMKYHLLPTEQRILMKSVRTRLRTPMNLPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPSRRCRAGMVYMAGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDVASRQCLSTVECYNATTNEWTYIAEMSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPTTDKWTVVSSCMSTGRSYAGVTVIDKRL

• Full Name: kelch-like 2, Mayven (Drosophila)
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC022503
• Gene Symbol: KLHL2
• Gene ID (NCBI): 11275
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95198
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KLHL2 contains an SH3-binding domain in the N terminus and a POZ domain and 6 tandem repeats of approximately 50 amino acids each in the C terminus. In astrocytoma/glioblastoma cells, KLHL2 colocalized with actin filaments in the cytoskeleton remodeling regions in stress fibers and in patchy cortical actin-rich regions of the cell margins. In primary rat hippocampal neurons, it was highly expressed in the cell body and in neurite processes(PMID: 10397770).