KLK11 Monoclonal antibody, PBS Only

• 

  WB analysis using 67427-1-Ig (same clone as 67427-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67427-1-Ig (KLK11 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67427-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67427-1-Ig (same clone as 67427-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67427-1-Ig (KLK11 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67427-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67427-1-Ig (same clone as 67427-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67427-1-Ig (KLK11 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67427-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67427-1-Ig (same clone as 67427-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67427-1-Ig (KLK11 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67427-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67427-1-Ig (same clone as 67427-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67427-1-Ig (KLK11 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67427-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 67427-1-Ig (same clone as 67427-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67427-1-Ig (KLK11 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67427-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 67427-1-Ig (same clone as 67427-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67427-1-Ig (KLK11 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67427-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human breast cancer using 67427-1-Ig (same clone as 67427-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using KLK11 antibody (67427-1-Ig, Clone: 1E2B4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67427-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human breast cancer using 67427-1-Ig (same clone as 67427-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using KLK11 antibody (67427-1-Ig, Clone: 1E2B4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67427-1-PBS in a different storage buffer formulation.

KLK11 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67427-1-PBS

Clone No.1E2B4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA

Synonyms

Kallikrein 11, 1E2B4, EC:3.4.21.-, Kallikrein11, Kallikrein-11

---

Product Information

67427-1-PBS targets KLK11 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29895

  Product name: Recombinant human KLK11 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 58-250 aa of BC022068

  Sequence: LTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN

• Full Name: kallikrein-related peptidase 11
• Calculated Molecular Weight: 250 aa, 27 kDa
• Observed Molecular Weight: 30-40 kDa
• GenBank Accession Number: BC022068
• Gene Symbol: KLK11
• Gene ID (NCBI): 11012
• RRID: AB_2882666
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UBX7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KLK11(Kallikrein-11) is also named as PRSS20, TLSP and belongs to the peptidase S1 family and Kallikrein subfamily. It is a multifunctinal protease cleaving several substrates for kallikrein and trypsin and involved in normal physiology processes in bronchus. This full length protein has a signal peptide, a propeptide and four glycosylation sites. It has 4 isoforms produced by alternative splicing with the molecular weight of 31 kDa, 27 kDa,34 kDa and 30 kDa.