KLK11 Monoclonal antibody, PBS Only

KLK11 Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 67427-1-PBS
Clone No.1E2B4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA

Kallikrein 11, 1E2B4, EC:3.4.21.-, Kallikrein11, Kallikrein-11

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67427-1-PBS targets KLK11 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29895

Product name: Recombinant human KLK11 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 58-250 aa of BC022068

Sequence: LTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN

Predict reactive species
Full Name kallikrein-related peptidase 11
Calculated Molecular Weight 250 aa, 27 kDa
Observed Molecular Weight 30-40 kDa
GenBank Accession NumberBC022068
Gene Symbol KLK11
Gene ID (NCBI) 11012
RRIDAB_2882666
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9UBX7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

KLK11(Kallikrein-11) is also named as PRSS20, TLSP and belongs to the peptidase S1 family and Kallikrein subfamily. It is a multifunctinal protease cleaving several substrates for kallikrein and trypsin and involved in normal physiology processes in bronchus. This full length protein has a signal peptide, a propeptide and four glycosylation sites. It has 4 isoforms produced by alternative splicing with the molecular weight of 31 kDa, 27 kDa,34 kDa and 30 kDa.

Loading...
||
New chat Able
正在加载,请稍候...