KLK3/PSA Recombinant monoclonal antibody, PBS Only

• 

KLK3/PSA Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 84059-3-PBS

Clone No.241223G9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

KLK3, APS, EC:3.4.21.77, Gamma-seminoprotein, Kallikrein 3

---

Product Information

84059-3-PBS targets KLK3/PSA in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0869

  Product name: Recombinant Human KLK3/PSA protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-10*His

  Domain: 18-261 aa of NM_001648.2

  Sequence: APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

• Full Name: kallikrein-related peptidase 3
• Calculated Molecular Weight: 29 kDa
• GenBank Accession Number: NM_001648.2
• Gene Symbol: KLK3
• Gene ID (NCBI): 354
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07288-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.