KLKB1 Polyclonal antibody

KLKB1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27991-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, ELISA

Fletcher factor, Kininogenin, KLK3, KLKB1, Plasma kallikrein, Plasma prekallikrein, PPK

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, mouse pancreas tissue, rat kidney tissue, rat pancreas tissue
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27991-1-AP targets KLKB1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27491

Product name: Recombinant human KLKB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 65-348 aa of NM_000892

Sequence: MASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCF

Predict reactive species
Full Name kallikrein B, plasma (Fletcher factor) 1
Calculated Molecular Weight 71 kDa
Observed Molecular Weight52-70 kDa
GenBank Accession NumberNM_000892
Gene Symbol KLKB1
Gene ID (NCBI) 3818
RRIDAB_2881032
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP03952
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human Plasma Kallikrein, a serine protease also named as KLKB1, KLK3, PPK or Kininogenin, is synthesized in the liver and circulates in the plasma by binding to high molecular weight (HMW) kininogen or as a free zymogen. It cleaves HMW kininogen, its major physiological substrate, to release the potent vasodilator peptide bradykinin. It is also able to cleave a number of inactive precursor proteins to generate active products, such as plasminogen and prourokinase. Thus, it plays an important role in blood pressure regulation, fibrinolysis, and neutrophil activation. KLKB1 precursor contains a signal peptide (residues 1 to 19) and a pro form sequence (residues 20 to 638). Upon activation, the pro form is converted to a heavy chain and a light chain, which is linked by disulfide bonds and the latter contains the catalytic domain (PMID: 3521732). KLKB1 is a ~70 kDa protein and can be detected as 80-86 kDa(glycosylation form), 52 kDa(heavy chain), 36-44kDa(light chain) and 18 kDa(often detected in cancer) (PMID: 17963278, 3521732). KLKB1 may be a potential candidate serum biomarker of cancer. The antigen of this antibody just cover the heavy chain of KLKB1, so this antibody cannot recognize the light chain.

Protocols

Product Specific Protocols
WB protocol for KLKB1 antibody 27991-1-APDownload protocol
IHC protocol for KLKB1 antibody 27991-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...