KLRG1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KLRG1 Polyclonal antibody, PBS Only (10974-1-PBS)

• 

  WB analysis using 10974-1-AP (same clone as 10974-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10974-1-AP (KLRG1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10974-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human peripheral blood leukocyte using 10974-1-AP (same clone as 10974-1-PBS)

  Human peripheral blood leukocytes were subjected to SDS PAGE followed by western blot with 10974-1-AP (KLRG1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10974-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 10974-1-AP (same clone as 10974-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 10974-1-AP (KLRG1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10974-1-AP (same clone as 10974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10974-1-AP (KLRG1 Antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10974-1-AP (same clone as 10974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10974-1-AP (KLRG1 Antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10974-1-PBS in a different storage buffer formulation.

KLRG1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 10974-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

MAFA 2F1, MAFA, Killer cell lectin-like receptor subfamily G member 1, ITIM-containing receptor MAFA-L, C-type lectin domain family 15 member A

---

Product Information

10974-1-PBS targets KLRG1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1407

  Product name: Recombinant human KLRG1 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-195 aa of BC012621

  Sequence: MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

• Full Name: killer cell lectin-like receptor subfamily G, member 1
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC012621
• Gene Symbol: KLRG1
• Gene ID (NCBI): 10219
• RRID: AB_2234383
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96E93
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KLRG1 (killer cell lectin-like receptor subfamily G, member 1) is a C-type lectin inhibitory receptor that contains an immunoreceptor tyrosine-based inhibitory motif (ITIM) in its cytoplasmic domain. KLRG1 is expressed by subsets of NK and T cells, existing both as a monomer and as a disulfide-linked homodimer (PMID: 10741410; 19604491). It is considered to be a cell differentiation marker for NK and T cells and is strongly induced by viral and other infections (PMID: 20373518). Through interactions with members of the cadherin family, KLRG1 plays an inhibitory role in NK- and T-cell function (PMID: 19009530; 20373518). Because of the glycosylation and disulfide bonds of the KLRG1 proteins, the observed molecular weights are typically 30-38 kDa (PMID: 17404256).