KLRK1 Polyclonal antibody

• 

KLRK1 Polyclonal Antibody for ELISA

Cat No. 15153-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

CD314, D12S2489E, KLR, KLRK1, NK cell receptor D, NKG2 D, NKG2 D activating NK receptor, NKG2D

---

Published Applications

• WB: See 1 publications below

Product Information

15153-1-AP targets KLRK1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5929

  Product name: Recombinant human KLRK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 73-216 aa of BC039836

  Sequence: IWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

• Full Name: killer cell lectin-like receptor subfamily K, member 1
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: BC039836
• Gene Symbol: KLRK1
• Gene ID (NCBI): 22914
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P26718
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cancer Biol Med; The PI3K/Akt/GSK-3β/ROS/eIF2B pathway promotes breast cancer growth and metastasis via suppression of NK cell cytotoxicity and tumor cell susceptibility.; Authors - Fengjiao Jin