KNCN Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KNCN Polyclonal antibody (21532-1-AP)

• 

  IHC staining of mouse liver using 21532-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 21532-1-AP (KNCN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 21532-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 21532-1-AP (KNCN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

KNCN Polyclonal Antibody for IHC, ELISA

Cat No. 21532-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

Kino, kinocilin

---

Tested Applications

• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21532-1-AP targets KNCN in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16160

  Product name: Recombinant human KNCN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-75 aa of BC101295

  Sequence: GLLILAYPFLKARFNLDHILPTIGSLRIHPHPGADHGEGRSSTNGNKEGARSSLSTVSRTLEKLKPGTRGAEEC

• Full Name: kinocilin
• Calculated Molecular Weight: 124 aa, 13 kDa
• GenBank Accession Number: BC101295
• Gene Symbol: KNCN
• Gene ID (NCBI): 148930
• RRID: AB_3742043
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A6PVL3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Kinocilin (KNCN) was first detected in the kinocilia of vestibular and auditory hair cells at embryonic days 14.5 and 18.5, respectively. In mature auditory hair cells, KNCN was present at the cuticular plate, at the base of each stereocilium. KNCN was also expressed by the pillar cells and Deiters cells, both of which contain prominent transcellular and apical bundles of microtubules. KNCN expression was detected in both cochlear and vestibular hair cells. KNCN plays a role in stabilizing dense microtubular networks or invesicular trafficking (PMID: 30254566).