Tested Applications
| Positive WB detected in | HepG2 cells, Jurkat cells, L02 cells, Raji cells, Ramos |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10819-1-AP targets KPNA2 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1153 Product name: Recombinant human KPNA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 231-529 aa of BC005978 Sequence: WTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAENLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF Predict reactive species |
| Full Name | karyopherin alpha 2 (RAG cohort 1, importin alpha 1) |
| Calculated Molecular Weight | 57.8 kDa |
| Observed Molecular Weight | 55-58 kDa |
| GenBank Accession Number | BC005978 |
| Gene Symbol | KPNA2 |
| Gene ID (NCBI) | 3838 |
| RRID | AB_2265526 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P52292 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KPNA2 (karyopherin α2) is a nuclear import factor involved in the nucleocytoplasmic transport system. It is functionally involved in the tumor progression and is elevated in multiple cancers. KPNA2 expression may be a useful prognostic biomarker to monitor cancer prognosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for KPNA2 antibody 10819-1-AP | Download protocol |
| IHC protocol for KPNA2 antibody 10819-1-AP | Download protocol |
| IP protocol for KPNA2 antibody 10819-1-AP | Download protocol |
| WB protocol for KPNA2 antibody 10819-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The KPNA2 Polyclonal antibody (Cat# 10819-1-AP) has 63 citations. These appear in journals including Nature, Molecular Cancer, Cell Research, Molecular Cell, Science Advances, Cell Death & Differentiation, Oncogene, Cell Reports, and the Journal of Virology. Research fields span cancer biology (lung, breast, gastric, colorectal, and other cancers), nuclear transport, ferroptosis, viral infection, neurodegeneration (ALS), and immunology, with applications mainly in Western blot, IHC, IF, and CoIP.
| Species | Application | Title |
|---|---|---|
Mol Cancer CREB3L1 promotes tumor growth and metastasis of anaplastic thyroid carcinoma by remodeling the tumor microenvironment
| ||
Cell Res Neddylation of PTEN regulates its nuclear import and promotes tumor development. | ||
Mol Cell EGFR promotes ALKBH5 nuclear retention to attenuate N6-methyladenosine and protect against ferroptosis in glioblastoma | ||
J Exp Clin Cancer Res ISG15 and ISGylation modulates cancer stem cell-like characteristics in promoting tumor growth of anaplastic thyroid carcinoma
| ||
Adv Sci (Weinh) ABHD17C-Mediated S-Depalmitoylation of BCL6B Enhances CD24 Transcription to Resist Macrophage Phagocytosis in Pancreatic Cancer. |
Reviews
What customers say
Both reviewers rated the antibody 4 out of 5 stars. It performed well in Western Blot at a 1:1000 dilution across human cancer cell lines and RPE-1/MSC cells. One reviewer additionally confirmed reliable Immunofluorescence results at 1:100 in permeabilized cells, with validation via siRNA knockdown. Overall, users report consistent performance and recommend the 1:1000 working dilution for optimal results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
María (Verified Customer) (02-08-2022) | Works for WB (1:1000) and IF in permeabilized cells (1:100). Validated with siRNA
|
Chandra (Verified Customer) (09-16-2019) | Works best at a 1:1000 antibody dilution.
 |
