KPTN Polyclonal antibody

• 

  WB analysis using 16094-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16094-1-AP (KPTN antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16094-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16094-1-AP (KPTN antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 16094-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 16094-1-AP (KPTN antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human cerebellum using 16094-1-AP

  human cerebellum tissue were subjected to SDS PAGE followed by western blot with 16094-1-AP (KPTN antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 16094-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 16094-1-AP (KPTN antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16094-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 16094-1-AP (KPTN antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 16094-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 16094-1-AP (KPTN antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human kidney using 16094-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 16094-1-AP (KPTN antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human placenta using 16094-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 16094-1-AP (KPTN antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human placenta using 16094-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 16094-1-AP (KPTN antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human skin using 16094-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 16094-1-AP (KPTN antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human skin using 16094-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 16094-1-AP (KPTN antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human spleen using 16094-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16094-1-AP (KPTN antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human spleen using 16094-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16094-1-AP (KPTN antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human lung using 16094-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 16094-1-AP (KPTN antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human lung using 16094-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 16094-1-AP (KPTN antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human ovary using 16094-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 16094-1-AP (KPTN antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human ovary using 16094-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 16094-1-AP (KPTN antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human heart using 16094-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 16094-1-AP (KPTN antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human heart using 16094-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 16094-1-AP (KPTN antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HeLa using 16094-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 16094-1-AP (KPTN antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

KPTN Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16094-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

KICSTOR complex protein kaptin, Kaptin, Actin-associated protein 2E4

---

Tested Applications

• Positive WB detected in: HeLa cells, NIH/3T3 cells, human cerebellum tissue, mouse skeletal muscle tissue
• Positive IHC detected in: human kidney tissue, human heart tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 12 publications below

Product Information

16094-1-AP targets KPTN in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8785

  Product name: Recombinant human KPTN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 79-436 aa of BC009249

  Sequence: EIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIVFSLSAAKETKDRPLQDEYSVLVASMLEPAVVYRDLLNRGLEDQLLLPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEAQHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRLRHQVEQRRRRLQGLEDGAGAGPAENAAS

• Full Name: kaptin (actin binding protein)
• Calculated Molecular Weight: 436 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC009249
• Gene Symbol: KPTN
• Gene ID (NCBI): 11133
• RRID: AB_2134007
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y664
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Kaptin, also named as KPTN and Actin-associated protein 2E4, originally isolated from human blood platelets and likely to be involved in the actin rearrangements occurring during activation. It plays a unique role in the actin rearrangements that accompany platelet activation and stereocilia formation. Kaptin is necessary for normal neuromorphogenesis. It may play a role in producing the sensory apparatus in hair cells.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; Structure of the nutrient-sensing hub GATOR2.; Authors - Max L Valenstein
human	WB	Nature; Architecture of the human GATOR1 and GATOR1-Rag GTPases complexes.; Authors - Kuang Shen
human	WB	Nature; KICSTOR recruits GATOR1 to the lysosome and is necessary for nutrients to regulate mTORC1.; Authors - Rachel L Wolfson ; KD Validated
human	WB	Proc Natl Acad Sci U S A; Rag-Ragulator is the central organizer of the physical architecture of the mTORC1 nutrient-sensing pathway; Authors - Max L Valenstein
human	WB	Cell Rep; CDK5-PRMT1-WDR24 signaling cascade promotes mTORC1 signaling and tumor growth; Authors - Shasha Yin ; KO Validated
human	WB	Cells; The SZT2 Interactome Unravels New Functions of the KICSTOR Complex.; Authors - Cecilia Cattelani