KRBP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KRBP Polyclonal antibody, PBS Only (10386-1-PBS)

• 

  WB analysis of mouse liver using 10386-1-AP (same clone as 10386-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10386-1-AP (KRBP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10386-1-PBS in a different storage buffer formulation.

KRBP Polyclonal Antibody for WB, Indirect ELISA

Cat No. 10386-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

10386-1-PBS targets KRBP in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0585

  Product name: Recombinant human KRBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 141-380 aa of BC001791

  Sequence: NGRELCDCEQCGEVFSEHSCLKTHVRTQSTGNTHDCNQYGKDFLTLCEKTSTGEKLSEFNQSEKIFSLTPNIVYQRTSTQEKSFECSHCGKSFINESYLQAHMRTHNGEKLYEWRNYGPGFIDSTSLSVLIETLNAKKPYKCKECGKGYRYPAYLSIHMRTHTGEKPYECKECGKAFNYSNSFQIHGRTHTGEKPYVCKECGKAFTQYSGLSMHVRSHSGDKPYECKECGKSFLTSSRLI

• Full Name: zinc finger protein 426
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC001791
• Gene Symbol: ZNF426
• Gene ID (NCBI): 79088
• RRID: AB_2242273
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUY5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF426 is a 554 amino acid protein, which contains one KRAB domain and twelve C2H2-type zinc fingers. ZNF426 localizes in the nucleus and may be involved in transcriptional regulation.