KREMEN1 Polyclonal antibody

• 

  WB analysis using 25434-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25434-1-AP (KREMEN1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

KREMEN1 Polyclonal Antibody for WB, ELISA

Cat No. 25434-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Dickkopf receptor, KREMEM1, KREMEN, Kremen protein 1, KREMEN1, KRM1

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25434-1-AP targets KREMEN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22092

  Product name: Recombinant human KREMEN1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 234-458 aa of BC063787

  Sequence: DTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGWTVYGLATLLILTVTAIVAKILLHVTFKSHRVPASGDLRDCHQPGTSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNPLVSD

• Full Name: kringle containing transmembrane protein 1
• Calculated Molecular Weight: 473 aa, 52 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC063787
• Gene Symbol: KREMEN1
• Gene ID (NCBI): 83999
• RRID: AB_3669475
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MU8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Kringle containing transmembrane protein 1 (KREMEN1, also known as KRM1, ECTD13, and KREMEN) is a transmembrane receptor located in the membrane. During the development of various organs, including the nervous system, limbs, and liver, KREMEN1 synergizes with the Dkk proteins to inhibit Wnt signaling (PMID: 18505822). KREMEN1 has been reported as a tumor suppressor, preventing cancer cell survival in a ligand-poor environment (PMID: 31069116). Variations and mutations of KREMEN1 have been associated with ectodermal dysplasia and Hand-foot-and-mouth disease (PMID: 34028942; 31911601).