KRI1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KRI1 Polyclonal antibody, PBS Only (16243-1-PBS)

• 

  WB analysis using 16243-1-AP (same clone as 16243-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16243-1-AP (KRI1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16243-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16243-1-AP (same clone as 16243-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using KRI1 antibody (16243-1-AP) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 16243-1-PBS in a different storage buffer formulation.

KRI1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 16243-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

KRI 1

---

Product Information

16243-1-PBS targets KRI1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9171

  Product name: Recombinant human KRI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 87-436 aa of BC009876

  Sequence: KNLKRKEILAKLEKLRKVTGNEMLGLEEGDLEDDFDPAQHDQLMQKCFGDEYYGAVEEEKPQFEEEEGLEDDWNWDTWDGPEQEGDWSQQELHCEDPNFNMDADYDPSQPRKKKREAPLTGKKKRKSPFAAAVGQEKPVFEPGDKTFEEYLDEYYRLDYEDIIDDLPCRFKYRTVVPCDFGLSTEEILAADDKELNRWCSLKKTCMYRSEQEELRDKRAYSQKAQNSWKKRQVFKSLCREEAETPAEATGKPQRDEAGPQRQLPALDGSLMGPESPPAQEEEAPVSPHKKPAPQKRRRAKKARLLGPTVMLGGCEFSRQRLQAFGLNPKRLHFRQLGRQRRKQQGPKNSP

• Full Name: KRI1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 709 aa, 80 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC009876
• Gene Symbol: KRI1
• Gene ID (NCBI): 65095
• RRID: AB_2878235
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N9T8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.