KRR1 Polyclonal antibody

• 

  WB analysis of human brain using 12772-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12772-1-AP (KRR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human kidney using 12772-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12772-1-AP (KRR1 antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 12772-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 12772-1-AP (KRR1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

KRR1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 12772-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Rip-1, RIP 1, Rev-interacting protein 1, KRR-R motif-containing protein 1, HRB2

---

Tested Applications

• Positive WB detected in: human brain tissue, human kidney tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12772-1-AP targets KRR1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3464

  Product name: Recombinant human KRR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-381 aa of BC026107

  Sequence: MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVALDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK

• Full Name: KRR1, small subunit (SSU) processome component, homolog (yeast)
• Calculated Molecular Weight: 381 aa, 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC026107
• Gene Symbol: KRR1
• Gene ID (NCBI): 11103
• RRID: AB_2134283
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13601
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.