Cytokeratin 13 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP00074-2

  Sandwich ELISA standard curve of MP00074-2, Human Cytokeratin 13 Recombinant Matched Antibody Pair - PBS only. 83058-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag0217. 83058-5-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL.

• 

  Sample test of MP00074-2

  The mean Cytokeratin 13 concentration was determined to be 28.00 ng/mL in A431 cell extract based on a 1.50 mg/mL extract load and 12.84 ng/mL in MCF-7 cell extract based on a 1.20 mg/mL extract load.

• 

  Affinity and Kinetic Characterization of 83058-5-PBS

  Biolayer interferometry (BLl) kinetic assay of 83058-5-PBS against Human Cytokeratin 13 was performed. The affinity constant is 2.28 nM.

Cytokeratin 13 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83058-5-PBS

Clone No.230366C3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

KRT13, CK 13, CK13, CK-13, ck17

---

Product Information

83058-5-PBS targets Cytokeratin 13 as part of a matched antibody pair:

MP00074-2: 83058-1-PBS capture and 83058-5-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0217

  Product name: Recombinant human KRT13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 183-458 aa of BC002661

  Sequence: ARLAVDDFRLKYENELALRQSVEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP

• Full Name: keratin 13
• Calculated Molecular Weight: 50 kDa
• GenBank Accession Number: BC002661
• Gene Symbol: Cytokeratin 13
• Gene ID (NCBI): 3860
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13646
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.