Cytokeratin 40 Polyclonal antibody

• 

  WB analysis of A431 using 25398-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 25398-1-AP (KRT40 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

Cytokeratin 40 Polyclonal Antibody for WB, ELISA

Cat No. 25398-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CK 40, Cytokeratin 40, K40, KA36, keratin 40, KRT40, Type I hair keratin Ka36

---

Tested Applications

• Positive WB detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25398-1-AP targets Cytokeratin 40 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21889

  Product name: Recombinant human KRT40 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-87 aa of BC150191

  Sequence: MTSDCSSTHCSPESCGTASGCAPASSCSVETACLPGTCATSRCQTPSFLSRSRGLTGCLLPCYFTGSCNSPCLVGNCAWCEDGVFTS

• Full Name: keratin 40
• Calculated Molecular Weight: 431 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC150191
• Gene Symbol: Cytokeratin 40
• Gene ID (NCBI): 125115
• RRID: AB_2880059
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6A162
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.