KRTAP3-1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KRTAP3-1 Polyclonal antibody, PBS Only (21673-1-PBS)

• 

  WB analysis using 21673-1-AP (same clone as 21673-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21673-1-AP (KRTAP3-1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21673-1-PBS in a different storage buffer formulation.

KRTAP3-1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21673-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

KAP3.1, KRTAP3 1, KRTAP3.1

---

Product Information

21673-1-PBS targets KRTAP3-1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16508

  Product name: Recombinant human KRTAP3-1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 37-98 aa of BC113077

  Sequence: PHEISLLQPICCDTCPPPCCKPDTYVPTCWLLNNCHPTPGLSGINLTTYVQPGCESPCEPRC

• Full Name: keratin associated protein 3-1
• Calculated Molecular Weight: 98 aa, 11 kDa
• Observed Molecular Weight: 10-15 kDa
• GenBank Accession Number: BC113077
• Gene Symbol: KRTAP3-1
• Gene ID (NCBI): 83896
• RRID: AB_3742048
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYR8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KRTAP3-1 is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers.