Kindlin 2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Kindlin 2 Polyclonal antibody, PBS Only (29911-1-PBS)

• 

  WB analysis using 29911-1-AP (same clone as 29911-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29911-1-AP (Kindlin 2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29911-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 29911-1-AP (same clone as 29911-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 29911-1-AP (Kindlin 2 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29911-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 29911-1-AP (same clone as 29911-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 29911-1-AP (Kindlin 2 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29911-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 29911-1-AP (same clone as 29911-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 29911-1-AP (Kindlin 2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29911-1-PBS in a different storage buffer formulation.

Kindlin 2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29911-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

FERMT2, FERMT 2, mig 2, Kindlin-2, kindlin2

---

Product Information

29911-1-PBS targets Kindlin 2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31795

  Product name: Recombinant human Kindlin 2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 331-441 aa of BC017327

  Sequence: TSENHLNNSDKEVDEVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNI

• Full Name: fermitin family homolog 2 (Drosophila)
• Calculated Molecular Weight: 680 aa, 78 kDa
• Observed Molecular Weight: 78 kDa
• GenBank Accession Number: BC017327
• Gene Symbol: Kindlin 2
• Gene ID (NCBI): 10979
• RRID: AB_3086186
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AC1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FERMT2, also named as KIND2, MIG2, PLEKHC1, MIG-2 and Kindlin-2, belongs to the kindlin family. There are three FERMT2 isoforms that participate in the connection between extracellular matrix (ECM) adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. FERMT2 recruits migfilin (FBLP1) protein to cell-ECM focal adhesion sites. Variable expression in human cancers and mesenchymal cancer invasion are now linked with FERMT2, which may plays important role in carcinormas development.