Klk1 Recombinant monoclonal antibody

• 

  WB analysis of mouse pancreas using 86143-1-RR

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 86143-1-RR (Klk1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse pancreas using 86143-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 86143-1-RR (Klk1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse pancreas using 86143-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 86143-1-RR (Klk1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse pancreas using 86143-1-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse pancreas tissue using Klk1 antibody (86143-1-RR, Clone: 250034D2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse pancreas using 86143-1-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse pancreas tissue using Klk1 antibody (86143-1-RR, Clone: 250034D2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Klk1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 86143-1-RR

Clone No.250034D2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

Kallikrein 1, EC:3.4.21.35, Glandular kallikrein K1, KAL-B, Kallikrein-1

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue
• Positive IHC detected in: mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86143-1-RR targets Klk1 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2996

  Product name: recombinant mouse Klk1 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 19-261 aa of NM_001320331.1

  Sequence: PPVQSRIVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWVLTAAHCHNDKYQVWLGKNNFLEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVKYEYPDELQCVNLKLLPNEDCAKAHIEKVTDDMLCAGDMDGGKDTCAGDSGGPLICDGVLQGITSWGPSPCGKPNVPGIYTRVLNFNTWIRETMAEND

• Full Name: kallikrein 1
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 28-34 kDa
• GenBank Accession Number: NM_001320331.1
• Gene Symbol: Klk1
• Gene ID (NCBI): 16612
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15947
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mouse KLK1 (Kallikrein-Related Peptidase 1) is a serine protease belonging to the kallikrein family with important physiological functions. KLK1 can cleave the Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Bradykinin plays an important role in regulating vasodilation, lowering blood pressure, smooth muscle relaxation and contraction, pain induction and inflammatory response.