Kv4.2 Recombinant monoclonal antibody

Kv4.2 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, ELISA
Cat No. 85133-3-RR
Clone No.242754F4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

KCND2, 242754F4, KIAA1044, Potassium voltage-gated channel subfamily D member 2, RK5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, DU 145 cells, A549 cells
Positive IHC detected inmouse cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85133-3-RR targets Kv4.2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15879

Product name: Recombinant human KCND2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 435-630 aa of BC110449

Sequence: AAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL

Predict reactive species
Full Name potassium voltage-gated channel, Shal-related subfamily, member 2
Calculated Molecular Weight 630 aa, 71 kDa
Observed Molecular Weight75 kDa
GenBank Accession NumberBC110449
Gene Symbol KCND2
Gene ID (NCBI) 3751
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NZV8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Voltage-gated potassium or Kv channels, specifically those mediating low threshold, rapidly inactivating Ito and IA currents, are known to regulate cardiac and neuronal membrane excitability, respectively (PMID: 12829703). Voltage-gated potassium channel subunit Kv4.2, encoded by the KCND2 gene, belongs to the potassium channel family and D (Shal) subfamily. It is a pore-forming alpha subunit of voltage-gated rapidly inactivating A-type potassium channels. Kv4.2 is highly expressed in the brain (PMID: 10551270). It is a major constituent of A-type potassium currents and a key regulator of neuronal membrane excitability (PMID: 22539834).

Protocols

Product Specific Protocols
IF protocol for Kv4.2 antibody 85133-3-RRDownload protocol
IHC protocol for Kv4.2 antibody 85133-3-RRDownload protocol
WB protocol for Kv4.2 antibody 85133-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...