• Featured Product
  • KD/KO Validated

L2HGDH Polyclonal antibody

L2HGDH Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15707-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

C14orf160, DURANIN, L2HGDH

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, rat brain tissue, mouse small intestine tissue, SGC-7901 cells, MCF-7 cells
Positive IHC detected inhuman liver cancer tissue, human gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15707-1-AP targets L2HGDH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8382

Product name: Recombinant human L2HGDH protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-351 aa of BC006117

Sequence: MVPALRYLVGACGRARGRFAGGSPGACGFASGRPRPLCGGSRSASTSSFDIVIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDI

Predict reactive species
Full Name L-2-hydroxyglutarate dehydrogenase
Calculated Molecular Weight463aa,50 kDa; 441aa,49 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberBC006117
Gene Symbol L2HGDH
Gene ID (NCBI) 79944
RRIDAB_2133202
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H9P8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

L2HGDH(L-2-hydroxyglutarate dehydrogenase, mitochondrial) is also named as duranin, C14orf160 and belongs to the L2HGDH family. The putative L2HGDH is predicted to be targeted to the mitochondria where its mitochondrial targeting sequence is presumably removed(PMID:16005139). Defects in L2HGDH are the cause of L-2-hydroxyglutaric aciduria (L2HGA). It has 2 isoforms produced by alternative splicing with the molecular weight of 50 kDa and 48 kDa. L2HGDH also can be detected as ~45kD due to the 51aa transit peptide cleaved.

Protocols

Product Specific Protocols
WB protocol for L2HGDH antibody 15707-1-APDownload protocol
IHC protocol for L2HGDH antibody 15707-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Metab

Hypoxia Induces Production of L-2-Hydroxyglutarate.

Authors - Andrew M Intlekofer
  • KD Validated
humanWB

Cell Metab

Hypoxia-Mediated Increases in L-2-hydroxyglutarate Coordinate the Metabolic Response to Reductive Stress.

Authors - William M Oldham
  • KD Validated
humanWB

Sci Transl Med

2-Hydroxyglutarate produced by neomorphic IDH mutations suppresses homologous recombination and induces PARP inhibitor sensitivity.

Authors - Parker L Sulkowski
  • KD Validated
humanWB

Sci Adv

Lipoylation inhibition enhances radiation control of lung cancer by suppressing homologous recombination DNA damage repair

Authors - Jui-Chung Chiang
humanWB

Cancer Discov

L-2-Hydroxyglutarate: an epigenetic modifier and putative oncometabolite in renal cancer.

Authors - Eun-Hee Shim
humanWB

Cell Chem Biol

MYC Regulation of D2HGDH and L2HGDH Influences the Epigenome and Epitranscriptome.

Authors - ZhiJun Qiu
  • KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Anirban (Verified Customer) (12-05-2021)

24 ug protein/lane. One non specific band observed above the KD band. 5% milk was used to block (1 hr incubation) and in secondary Ab (1/5000 dilution-45 minutes incubation). Primary Ab was diluted in 3% BSA (1.5 hrs incubation. All were done in TBST (0.1% Tween 20). Nitrocellulose membrane was used.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Renca (mouse renal cancer cell line)
L2HGDH Antibody Western Blot validation (1/1000 dilution) in Renca (mouse renal cancer cell line) (Cat no:15707-1-AP)
FH

Daniel (Verified Customer) (09-30-2019)

Tissue was boiled in SDS-sample buffer and separated by size on an SDS-PAGE.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse liver
L2HGDH Antibody Western Blot, validation (1:1000 dilution) in Mouse liver (Cat no:15707-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...