L3HYPDH Polyclonal antibody

• Home
• Products
• Primary Antibodies
• L3HYPDH Polyclonal antibody (33146-1-AP)

• 

  WB analysis using 33146-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33146-1-AP (L3HYPDH antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

L3HYPDH Polyclonal Antibody for WB, ELISA

Cat No. 33146-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

C14orf149, EC:4.2.1.77, Trans-3-hydroxy-L-proline dehydratase, Trans-L-3-hydroxyproline dehydratase

---

Tested Applications

• Positive WB detected in: HepG2 cells, PC-3 cells, mouse kidney tissue, mouse liver tissue, rat kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33146-1-AP targets L3HYPDH in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37121

  Product name: Recombinant human C14orf149 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 195-354 aa of BC012131

  Sequence: VTAEKLGLDICSAKTRDLVDAASAVTEAVKAQFKINHPDSEDLAFLYGTILTDGKDAYTKEPTTNICVFADEQVDRSPTGSGVTARIALQYHKGLLELNQMRAFKSSATGSVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIIEDDDPLRDGFLLK

• Full Name: chromosome 14 open reading frame 149
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC012131
• Gene Symbol: C14orf149
• Gene ID (NCBI): 112849
• RRID: AB_3742871
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96EM0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Trans-3-hydroxy-L-proline dehydratase (L3HYPDH) is an enzyme that catalyzes the conversion of trans-3-hydroxy-L-proline to delta(1)-pyrroline-2-carboxylate. This enzyme is involved in the degradation of dietary proteins containing trans-3-hydroxy-L-proline, such as collagen IV. Additionally, L3HYPDH has been identified as an interferon-stimulated gene (ISG) with antiviral activity, particularly against viruses like EV71 (PMID: 35891782). It also plays a role in the genetic regulation of working memory and has been implicated in the mitochondrial pathway associated with autism spectrum disorder (PMID: 32490597).