L3MBTL2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• L3MBTL2 Polyclonal antibody, PBS Only (24435-1-PBS)

• 

  WB analysis using 24435-1-AP (same clone as 24435-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24435-1-AP (L3MBTL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24435-1-PBS in a different storage buffer formulation.

L3MBTL2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24435-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

L(3)mbt-like protein 2, L(3)mbt like protein 2, l(3)mbt like 2 (Drosophila), H-l(3)mbt-like protein 2, H l(3)mbt like protein 2

---

Product Information

24435-1-PBS targets L3MBTL2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19571

  Product name: Recombinant human L3MBTL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 284-427 aa of BC017191

  Sequence: RTIHAKFTDWKGYLMKRLVGSRTLPVDFHIKMVESMKYPFRQGMRLEVVDKSQVSRTRMAVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSERRSDMAHHPTFRKIYCDAVPYLFKKVRAVYTEGGW

• Full Name: l(3)mbt-like 2 (Drosophila)
• Calculated Molecular Weight: 705 aa, 79 kDa
• Observed Molecular Weight: 95-100 kDa
• GenBank Accession Number: BC017191
• Gene Symbol: L3MBTL2
• Gene ID (NCBI): 83746
• RRID: AB_3085733
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q969R5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

L3MBTL2 (Lethal (3) malignant brain tumor like 2) is a member of the MBT-domain proteins, which are involved in transcriptional repression and implicated in chromatin compaction. L3MBTL2 was most highly expressed in pachytene spermatocytes within the testis (PMID: 30760872).In addition, mutations in L3MBTL2 are prevalent in various cancers including leukemia, a disease characterized by alterations in multiple DNA repair proteins (PMID: 29581593).