LACC1 Polyclonal antibody

• 

  WB analysis using 27895-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27895-1-AP (LACC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 27895-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27895-1-AP (LACC1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

LACC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27895-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

C13orf31, Adenosine deaminase LACC1, FAMIN, EC:3.5.4.4, EC:2.4.2.28

---

Tested Applications

• Positive WB detected in: mouse lung tissue, mouse stomach tissue
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

27895-1-AP targets LACC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27308

  Product name: Recombinant human C13orf31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 49-267 aa of BC035749

  Sequence: NISYERDGEQDNCEIETSNGLSALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVIVPRHRKTLMKAFIDQLFTDVYNFEFEDLQVTFRGGLFKQSIEINVITAQELRGIQNEIETFLRSLPALRGKLTIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQENLRRLANAAGFNVEKFYRIKTHHSNDIWIMGRKEPDSYDG

• Full Name: chromosome 13 open reading frame 31
• Calculated Molecular Weight: 430 aa, 48 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC035749
• Gene Symbol: LACC1
• Gene ID (NCBI): 144811
• RRID: AB_3086004
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IV20
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Cardiovasc Transl Res; LACC1 Enhances Polyamine Immunometabolism in Inflammatory Macrophages to Inhibit Atherosclerosis Progression; Authors - Jingyong Zhang