Filter: AllIHC

IHC staining of human breast cancer using 18271-1-AP (same clone as 18271-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer using 18271-1-AP (LACRT antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18271-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 18271-1-AP (same clone as 18271-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer using 18271-1-AP (LACRT antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18271-1-PBS in a different storage buffer formulation.

LACRT Polyclonal antibody, PBS Only

Name: LACRT Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 18271-1-PBS

LACRT Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 18271-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

18271-1-PBS targets LACRT in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag12905 Product name: Recombinant human LACRT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-138 aa of BC069317 Sequence: EDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA Predict reactive species
Full Name	lacritin
Calculated Molecular Weight	138 aa, 14 kDa
GenBank Accession Number	BC069317
Gene Symbol	LACRT
Gene ID (NCBI)	90070
RRID	AB_10598465
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9GZZ8
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™