LAG-3/CD223 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HuT 78 using 80855-7-RR (same clone as 80855-7-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 80855-7-RR (LAG3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80855-7-PBS in a different storage buffer formulation.

LAG-3/CD223 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 80855-7-PBS

Clone No.243086D9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CD223, LAG3, FDC, LAG 3, LAG-3

---

Product Information

80855-7-PBS targets LAG-3/CD223 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg31550

  Product name: Recombinant Human LAG3 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 23-450 aa of NM_002286

  Sequence: LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

• Full Name: lymphocyte-activation gene 3
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_002286
• Gene Symbol: LAG-3
• Gene ID (NCBI): 3902
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P18627
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LAG-3, also known as CD223, is an immune checkpoint molecule that regulates both T-cell activation and homeostasis. LAG-3 is expressed on activated T cells, NK cells, regulatory T cells, and plasmacytoid dendritic cells. It is a CD4-related molecule that binds MHC class II. LAG-3 plays an important role in modulating T cell expansion and function, and blockade of LAG-3 with monoclonal antibodies can augment T cell function. (PMID: 15634887; 21086108; 28783703)