Anti-Human LAG-3/CD223 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human LAG-3/CD223 Rabbit Recombinant Antibody (98435-3-RR)

• 

  IHC staining of human tonsillitis using 98435-3-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 98435-3-RR (LAG3 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 98435-3-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 98435-3-RR (LAG3 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of human PBMCs using 98435-3-RR

  1x10^6 untreated or anti-CD3/CD28 and IL-2 treated human PBMCs were surface stained with 0.25 ug Anti-Human LAG3 Rabbit RecAb (98435-3-RR, Clone:243086H8) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with CoraLite® Plus 647 Anti-Human CD8 (UCHT4) Mouse IgG2a Recombinant Antibody (CL647-65559, Clone: UCHT4). Cells were not fixed.

• 

  FC experiment of human PBMCs using 98435-3-RR

  1x10^6 anti-CD3/CD28 and IL-2 treated human PBMCs were surface stained with 0.25 ug Anti-Human LAG3 Rabbit RecAb (98435-3-RR, Clone: 243086H8) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated human PBMCs were surface stained with 0.25 ug Anti-Human LAG3 Rabbit RecAb (98435-3-RR, Clone: 243086H8) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (black, dashed). Cells were not fixed.

• 

  Affinity of 98435-3-RR

  Biolayer interferometry (BLl) kinetic assays of 98435-3-RR against Human LAG-3/CD223 were performed. The affinity constant is 0.889 nM.

LAG-3/CD223 Uni-rAb^® Recombinant Antibody for IHC, FC

Cat No. 98435-3-RR

Clone No.243086H8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, FC

Synonyms

CD223, LAG3, FDC, LAG 3, LAG-3

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC detected in: anti-CD3/CD28 and IL-2 treated human PBMCs

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98435-3-RR targets LAG-3/CD223 in IHC, FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg31550

  Product name: Recombinant Human LAG-3/CD223protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 23-450 aa of NM_002286

  Sequence: LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

• Full Name: lymphocyte-activation gene 3
• Calculated Molecular Weight: 57 kDa
• GenBank Accession Number: NM_002286
• Gene Symbol: LAG-3
• Gene ID (NCBI): 3902
• RRID: AB_3746073
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P18627
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

LAG-3, also known as CD223, is an immune checkpoint molecule that regulates both T-cell activation and homeostasis. LAG-3 is expressed on activated T cells, NK cells, regulatory T cells, and plasmacytoid dendritic cells. It is a CD4-related molecule that binds MHC class II. LAG-3 plays an important role in modulating T cell expansion and function, and blockade of LAG-3 with monoclonal antibodies can augment T cell function. (PMID: 15634887; 21086108; 28783703)